advertisement
▼
Scroll to page 2
of 80
Alignment & Troubleshooting 4. Alignment & Troubleshooting This chapter describes the main functions for service, such as the product maintenance method, the test output related to maintenance and repair, DCU using method, Jam removing method, and so on. It includes the contents of manual. 4.1 Alignment and Adjustments 4.1.1 Control Panel overview 1 ID Copy You can copy both sides of the ID Card like a driver’s license to a single side of paper. 2 Direct USB Allows you to directly print files stored on a USB Memory device when it is inserted into the USB memory port on the front of your machine. (SCX-4x28 Series only) Reduce/Enlarge Makes a copy smaller or larger than the original. (SCX-4x24 Series only) 3 Display Shows the current status and prompts during an operation. 4 Status Shows the status of your machine. 5 Fax Activates Fax mode. 6 Copy Activates Copy mode. 7 Scan/Email Activates Scan mode. 8 Menu Enters Menu mode and scrolls through the available menus. 9 Left/right arrow Scroll through the options available in the selected menu, and increase or decrease values. 10 OK Confirms the selection on the screen. 11 Back Sends you back to the upper menu level. 12 Number keypad Dials a number or enters alphanumeric characters. 13 Address Book Allows you to store frequently used fax numbers in memory or search for stored fax numbers or email addresses. 14 Redial/Pause In ready mode, redials the last number, or in Edit mode, inserts a pause into a fax number. 15 On Hook Dial Engages the telephone line. 16 Stop/Clear Stops an operation at any time. In ready mode, clears/cancels the copy options, such as the darkness, the document type setting, the copy size, and the number of copies. 17 Start Starts a job. Service Manual 4-1 Samsung Electronics Alignment & Troubleshooting 4.1.2 Understanding The Status LED The color of the Status LED indicates the machine’s current status. Status Description Off 7KHPDFKLQHLVSRZHUHGRIIOLQH 7KHPDFKLQHLVLQSRZHUVDYHPRGH:KHQGDWDLVUHFHLYHGRUDQ\ button is pressed, it switches to on-line automatically. Green Red Service Manual On 7KHPDFKLQHLVSRZHUHGRQDQGFDQEHXVHG Blinking :KHQWKHJUHHQ/('VORZO\EOLQNVWKHPDFKLQHLVUHFHLYLQJGDWDIURP the computer. :KHQWKHJUHHQ/('UDSLGO\EOLQNVWKHPDFKLQHLVSULQWLQJGDWD On $SUREOHPKDVRFFXUUHGVXFKDVDSDSHUMDPFRYHURSHQRUQRSDSHULQ the tray, so that the machine cannot continue the job. 7KHWRQHUFDUWULGJHLVHPSW\RUQHHGVWREHFKDQJHG Blinking $PLQRUHUURUKDVRFFXUUHGDQGWKHPDFKLQHLVZDLWLQJIRUWKHHUURUWREH cleared. 7KHWRQHUFDUWULGJHLVORZ2UGHUDQHZWRQHUFDUWULGJH 4-2 Samsung Electronics Alignment & Troubleshooting 4.1.3 Paper path Scanner Part PICK-UP52//(5 $')52//(5 COVER OPEN ADF-UPPER )(('52//(5 EXIT 52//(5 $')/2:(5 SCAN UPPER $')*/$66 :+,7(%$5 Engine Part LSU DEVE FUSER DUPLEX CASSETTE Service Manual 4-3 Samsung Electronics Alignment & Troubleshooting 4.1.3.1 Clearing Document Jams :KHQDQRULJLQDOMDPVZKLOHSDVVLQJWKURXJKWKH$')'RFXPHQW-DPDSSHDUVRQWKHGLVSOD\ Input Misfeed 4. Align the left end of the ADF roller with the slot and push the right end of the ADF roller into the right slot (1). Rotate the bushing on the right end of the roller toward the document input tray (2). 1. Remove any remaining pages from the ADF. 2. Open the ADF cover. 1 ADF cover 5. Close the ADF cover. Then load the removed page(s), if any, back into the ADF. 3. Rotate the bushing on the right end of the ADF roller toward the ADF (1) and remove the roller from the slot (2). Pull the document gently to the left and out of the ADF. Service Manual 4-4 Samsung Electronics Alignment & Troubleshooting Exit misfeed Roller misfeed 1. Remove any remaining pages from the ADF. 1. Open the scanner lid. 2. Seize the misfeed paper, and remove the paper from the document output tray by carefully pulling it to the right using both hands. 2. Seize the misfeed paper, and remove the paper from the feed area by carefully pulling it to the right using both hands. /RDGWKHUHPRYHGSDJHVEDFNLQWRWKH$') 3. Close the scanner lid. Then load the removed pages back into the ADF. Service Manual 4-5 Samsung Electronics Alignment & Troubleshooting 4.1.3.2 Clearing paper jams :KHQDSDSHUMDPRFFXUVWKHZDUQLQJPHVVDJHDSSHDUVRQWKHGLVSOD\VFUHHQ5HIHUWRWKHWDEOHEHORZWR locate and clear the paper jam. Message Location of jam Paper Jam 0 Open/Close Door In the paper feed area or inside the machine Paper Jam 1 Open/Close Door Inside the machine Paper Jam 2 Check Inside Inside the machine or in the fuser area Duplex Jam 0 Check Inside Inside the machine Duplex Jam 1 Open/Close Door In the paper feed area or inside the machine In the paper feed area 2. Remove the jammed paper by gently pulling it straight out as shown below. If paper is jammed in the paper feed area, follow the next steps to release the jammed paper. 1. Pull the tray open. If the paper does not move when you pull, or if you do not see the paper in this area, check In the toner cartridge area. 3. Insert the tray back into the machine. Printing automatically resumes. Service Manual 4-6 Samsung Electronics Alignment & Troubleshooting In the manual tray In the toner cartridge area :KHQ\RXSULQWXVLQJWKHPDQXDOWUD\DQGWKH machine detects that there is either no paper or that the paper has been improperly loaded, follow the next steps to release the jammed paper. If paper is jammed in the toner cartridge area, follow the next steps to release the jammed paper. 1. Open the front cover and pull the toner cartridge out 1. Check if the paper is stuck in the feeding area, and if so, pull it out gently and slowly. /RDGDSDSHULQWRWKHPDQXDOWUD\ 2. Remove the jammed paper by gently pulling it straight out as shown below. 3. Open the front cover and close it. The machine will resume printing. 3. Replace the toner cartridge and close the front cover. Printing automatically resumes. Service Manual 4-7 Samsung Electronics Alignment & Troubleshooting In the paper exit area In the duplex unit area If paper is jammed in the paper exit area, follow the next steps to release the jammed paper. If the duplex unit is not inserted correctly, paper jam may occur. Make sure that the duplex unit is inserted correctly. 1. If a long portion of the paper is visible, pull it straight out. Open and close the front cover ¿UPO\7KHPDFKLQHZLOOUHVXPHSULQWLQJ 1. Pull the duplex unit out of the machine. ,I\RXFDQQRW¿QGWKHMDPPHGSDSHURULIWKHUHLV any resistance removing the paper, stop pulling and go to step 2. 2. Remove the jammed paper from the duplex unit. 2. Open the rear cover. 3. Pull the guide rear on each side down and carefully take the jammed paper out of the machine. Return the guide rear to its original position. If the paper does not come out with the duplex unit, remove the paper from the bottom of the machine. 1 Guide rear 4. Close the rear cover. Printing automatically resumes. Service Manual ,I\RXFDQQRW¿QGWKHMDPPHGSDSHURULIWKHUHLV any resistance removing the paper, stop pulling and go to step 3. 4-8 Samsung Electronics Alignment & Troubleshooting 2. If you see the jammed paper, remove the paper from the machine by gently pulling it straight out as shown below. 3. Open the rear cover. 4. Pull the guide rear on each side down and remove the paper. Return the guide rear to its original position. ,I\RXFDQQRW¿QGWKHMDPPHGSDSHURULIWKHUHLV any resistance removing the paper, stop pulling and go to step 3. 3. Pull the tray half. 1 Guide rear 5. Close the rear cover. Printing automatically resumes. In the optional tray If paper is jammed in the optional Tray, follow the next steps to release the jammed paper. 1. Pull the optional tray open. 4. Remove the jammed paper by gently pulling the paper straight up and out. 5. Insert the trays back into the machine. Printing automatically resumes. Service Manual 4-9 Samsung Electronics Service Manual Darkness Resolution Multi Send Delay Send Prio rity Se nd Forw ard Secur e Receive Add Page Cancel Job Fax Feature Sending Redial Tim es Redial Term Prefix Dial ECM Mode Send Report Image TCR Dial Mode Receiv ing Receiv e Mode Rin g to An swer Fax Setup Fax Setup (Continued) Stamp Rcv Name Rcv Start Code Auto Re duction Discard Size Ju nk Fax Set up DRPD Mode Dupl ex Pri nt Change D efaul t Resoluti on Dark ness Auto Re port . TCP/IP Ethern et Spe ed Clear Settin g Network I nfo Network Reduce/Enlar ge Darkness Origina l Type /D\ out Norm al 2-Up 4-Up ID Copy Pos ter Cop y Clon e Cop y Adjus t Bk gd. Copy Feature Clear Settin g All S etting s Fax Setup Copy Setu p Scan Setup Sys tem Setup Network Addre ss B ook Sent Report Fax Rcv Repo rt System Setup (Continued) Duple x Change Default Copie s Copy Colla tion Redu ce/Enlar ge Darkness Origina l Type Copy Setup Report All Report Configura tion Supplie s Info Address Book Send Report Sent Report Fax Rcv Repor t Schedule Jobs Junk Fax Report Netw ork Info. User Auth /LV t Main tenance &/R Empty Msg Ignore Tone r Supplie V/ ife Serial N umbe r System Setup (Continued) USB Feature Scan Size Origina l Type Resolutio n Scan Colo r Scan Form at E-mail Fe ature Scan Size Origina l Type Resolutio n Scan Colo r Scan Form at Scan Feature Mach ine Setup Mach ine ID Mach ine Fax No. Date & Time Clock Mod e /Dngu age Default Mode Power Sav e Timeout Job Timeout Alt itude Adj. Import Setting Export Se tting Paper Setup Paper Si ze Paper Type Paper So urce Sound/Vo lum e Key Sou nd Ala rm Sound Speaker Ringer System Setup Change Default USB Default E-mail Defa ult Scan Setup Alignment & Troubleshooting 4.1.4 Menu Map The control panel provides access to various menus to set up the machine or use the machine’s functions. These menus can be accessed by pressing Menu. Refer to the following diagram. Menus available in Fax, Copy, or Scan mode vary. 4-10 Samsung Electronics Alignment & Troubleshooting 4.1.4.1 Accessing to menus The next steps are the example to print the menu map of this machine, and they are the general way to VHOHFWPHQXDQGFRQ¿JXUH\RXUPDFKLQH 1. Make sure your machine is properly connected all the necessary cables, and turn on the machine. 2. Press the Menu button until you see the menu (ex. Information) you want on the bottom line of the display. 3. Press the OK button to access the menu. 3UHVVWKH/HIWULJKWDUURZEXWWRQVXQWLOWKHPHQXLWHPH[0HQX0DS\RXZDQWGLVSOD\VRQWKHERWWRP line. 3UHVVWKH2.EXWWRQWRFRQ¿UPWKHVHOHFWHGLWHP 3UHVVWKH/HIWULJKWDUURZEXWWRQVXQWLOWKHPHQXLWHPH[3ULQW"\RXZDQWGLVSOD\VRQWKHERWWRPOLQH 7. Press the OK button to process your selection, save your input or selection. An asterisk (*) appears next to the selection on the display, indicating that it is now the default. 8. To exit the menu, press the Back button repeatedly, or the Stop button. Note - If you want to set the basic menu items, please consult the user guide. Service Manual 4-11 Samsung Electronics Alignment & Troubleshooting 4.1.5 Tech Mode 4.1.5.1 How to Enter Tech Mode In service (tech) mode, the technician can check the machine and perform various test to isolate the cause of a malfunction. :KLOHLQ7HFKPRGHWKHPDFKLQHVWLOOSHUIRUPVDOOQRUPDORSHUDWLRQV To enter the Tech mode To enter the Tech mode, press LQVHTXHQFHDQGWKH/&'EULHÀ\ GLVSOD\Vµ7(&+¶WKHPDFKLQHKDVHQWHUHGVHUYLFHWHFKPRGH 4.1.5.2 Setting-up System in Tech Mode In service (tech) mode, the technician can check the machine and perform various test to isolate the cause of a malfunction. SCX-4824FN/4828FN 6HQG/HYHO '70)/HYHO Pause Time Dial Mode Modem Speed Error Rate RDS Clear All Mem Clear Counts Flash Upgrade Silence Time Service Manual Switch Test Modem Test Dram Test Rom Test Pattern Test Shading Test 4-12 All Report Protocol Configuration .H\+LVWRU\ Error Info Usage Page Component Check Service Support Samsung Electronics Alignment & Troubleshooting 4.1.5.3 Data Setup SEND LEVEL You can set the level of the transmission signal. Typically, the Tx level should be under -12 dBm. &DXWLRQ7KH6HQG)D[/HYHOLVVHWDWWKHEHVWFRQGLWLRQLQWKHVKLSPHQWIURPIDFWRU\1HYHUFKDQJHVHWWLQJV arbitrarily. DIAL MODE This function can choose dial method. *Default : Dial(Dial/Pulse) MODEM SPEED You can set the maximum modem speed. Communication is done with modem speed automatically set at lower speed when communicating with a slower speed modem since communication is done on the standard of the side where modem speed is low for transmission/reception. It is best set 33.6Kbps as default setting. ERROR RATE :KHQWKHHUURUUDWHLVDERXWH[FHHGWKHVHWYDOXHWKH%DXGUDWHDXWRPDWLFDOO\DGMXVWVWRESV This ensures that the error rate remains below the set value. You can select the rate between 5% and 10%. CLEAR ALL MEMORY The function resets the system to factory default settings. This function is used to reset the system to the initial value when the product is functioning abnormally. All the values are returned to the default values, and all the information, which was set by the user, will be erased. < Method > 6HOHFWWKH>0(025<&/($5@DWWKH7(&+02'( 2. Push the OK button. 3. Select you country. (There are four country groups. Refer to the table below.) 4. Push the OK button then it will clear all memory. NOTICE : Always perform a memory clear after replacing the main board. Otherwise, the system may not operate properly. Country Group USA/Canada USA/Canada Mexico Brazil Country Service Manual UK UK Germany France Italy Spain Austria Netherlands Belgium Portugal Sweden Norway Denmark Finland Switzerland Greece Ireland Turkey 4-13 Russia Russia India Oman Poland Bangladesh Kuwait Moroco Algeria Pakistan UAE Bahrain Srilanka Saudi Arabia Chile Peru Argentina +XQJDU\ Romania Bulgaria Czech Southafrica South Africa Samsung Electronics Alignment & Troubleshooting Flash Upgrade 7KH)LUPZDUH8SJUDGHIXQFWLRQDQGKDVWZRPHWKRGV/RFDODQG5HPRWH 1) Local Machine Upgrade 5&35HPRWH&RQWURO3DQHOPRGH This method is for USB Port Connect to PC and activate RCP(Remote Control Panel) to upgrade the Firmware. < Method > +RZWR8SGDWH)LUPZDUHXVLQJ5&3 1. Connect PC and Printer with USB Cable. 2. Execute RCP and select Firmware Update. 6HDUFK)LUPZDUH¿OHWRXSGDWHZLWK%URZVH,FRQ &OLFN8SGDWHLFRQ¿UPZDUH¿OHLVWUDQVPLWWHGWR3ULQWHUDXWRPDWLFDOO\DQGSULQWHULVLQLWLDOL]HGZKHQLW ¿QLVKHG 5. Click Refresh icon and check what is updated. '26&RPPDQGPRGH This method is just for USB Port. Connect to PC with USB cable and enter DOS Command to upgrade the Firmware < Method > 7KH¿UVWRIDOOQHHGWKH¿OHVGRZQEDWGRZQBFRPELQISUWH[HDQG5RP)LOH¿OHQDPHIRUXSJUDGH 6DYHWKH¿OHVLQWKHVDPHIROGHU 2. In the DOS, input as below and push the enter key. Then, it will be automatically upgraded. 3. There are two commands for the conditions of product. :KHQWKHSURGXFWLVLQLGOHFRQGLWLRQGRZQ³URP¿OH´ :KHQWKHSURGXFWLVLQ5HDG\FRQGLWLRQ7(&+02'('$7$6(783)/$6+83*5$'(/2&$/FRS\E ³URP¿OH´OSW 4. Do not turn off the power while upgrading process. 2) Remote Upgrade 7KLVLVDIXQFWLRQWKDWDID[ZLWKWKHODWHVW¿UPZDUHVHQGV¿OHVWRDID[LQORQJGLVWDQFHWKURXJKWHOHSKRQH line. < Method > %HIRUHUHPRWHXSJUDGHWKHODWHVW¿UPZDUHVKRXOGEHORDGHGLQWRWKHPDFKLQH 7(&+02'('$7$6(783)/$6+83*5$'(5(027( 2. Input the fax number, which needs to be upgraded. (Several faxes can be upgraded at the same time. In this case, enter the each fax number.) $IWHUSXVKWKHHQWHUEXWWRQVHQGWKH¿UPZDUH¿OHE\FDOOLQJWRWKHDSSRLQWHGQXPEHU$URXQGa PLQXWHVQHHGVWRVHQGWKH¿OH < Caution > 1. sending and receiving fax must be the same model. 2. A sending fax must be set up as ECM mode, and a receiving memory must be set up as 100%. If not, the function operates abnormally Service Manual 4-14 Samsung Electronics Alignment & Troubleshooting S/W of Maintenance 1. Clearing the Memory <RXFDQVHOHFWLYHO\FOHDULQIRUPDWLRQVWRUHGLQ\RXUPDFKLQHVPHPRU\ 1) Press Menu on the control panel until Maintenance appears on the top line of the display. 2) Press the scroll button (left-key or right-key) until you see Clear Memory on the bottom line and press OK 7KH¿UVWDYDLODEOHPHQXLWHP&OHDU$OO0HPGLVSOD\VRQWKHERWWRPOLQH 6HHQH[WSDJH7KHUHDUHVRPHLWHPWRGLVSOD\RQWKH/&' 3) Press the scroll button (left-key or right-key) until you see the item you want to clear. 4) Press Enter. The selected memory is cleared and the display asks you to continue clearing the next item. 5) To clear another item, press Enter and repeat steps 3 and 4 - To return to Standby mode, press Stop/Clear. - As below item you can selectively clear information stored in your machine s memory. &OHDU$OO0HP - Clears all of the data stored in the memory and resets all of your settings to the factory default. 3DSHU6HWWLQJ - Restores all of the Paper Setting options to the factory default. &RS\6HWXS - Restores all of the Copy Setup options to the factory default. )D[6HWXS - Restores all of the Fax Setup options to the factory default. )D[)HDWXUH - Cancels all of the scheduled fax jobs in the machine s memory. - As below item you can selectively clear information stored in your machine s memory. $GYDQFHG)D[ - Restores all of the Advanced Fax setting options to the factory default. 6RXQG9ROXPH - Resets the sound and volume settings to the factory default. 0DFKLQH6HWXS - Resets all of the system settings, such as the machine ID, date and time, display language and save modes, to the factory default. 6HQW5HSRUW - Clears all of records of your faxes sent. 5&95HSRUW - Clears all of records of your faxes received. 3KRQH%RRN - Clears the one-touch, speed and group dial numbers stored in the memory. 2. Adjust shading :KHQWKHVFDQXQLWEHFRPHVGLUW\LWFDQDOWHUWKHVKDGLQJYDOXH ,I\RXUFRS\KDVEODFNOLQHVRULVEOXUUHGDGMXVWWKHVKDGLQJVHWWLQJ /RDGDVKHHWRIZKLWHSDSHULQWRWKH$') 2) Make machine Tech mode. 3) Press Menu on the control panel and scroll until Machine Test displays. 4) Scroll to Shading Test and Press OK. 5) Select Shading&Print appears on the bottom line and press OK. 6) Your machine picks up the paper and adjusts the shading value. 7) After adjusting, shading value will be printed with graphic image. Service Manual 4-15 Samsung Electronics Alignment & Troubleshooting 3. Remote Diagnostic System(RDS) 5'6DQG)7(*7$XWRPDWLF2UGHULQJ6\VWHPZLOOHQKDQFHWKHTXDOLW\DQGWKHVSHHGRIDIWHUVDOHV service and monitor the performance of the MFP at the customer site. 0)36KRXOGEHFRQQHFWHGE\0)36HUYHU 3.1 Required components of RDS RDS for MFP system consists of the following three components that communicate with each other 1. Main RDS Server connected to FAX-MODEM. 2. RDS Client Application. 3. RDS on MFP. 3.2 Enable of RDS on MFP This value is in Tech Mode. The factory default for Consumables Status Update / Error Proactive value is Disabled. < Method > 1. MFP Should be connected by RDS Server. 2. Service numbers should have the proper values. 7(&+02'(!'$7$6(783!127,)<721(5!5'6!6HUYLFH1XPEHU 3. Machine Serial No. should have the proper values. 7(&+02'(!'$7$6(783!127,)<721(5!7RQHU!6HULDO1R 4. Criter value input is optional, default is set to 1000-page. 7(&+02'(!'$7$6(783!127,)<721(5!5'6!&ULWHU9DOXH 5. Remote Test should be On 0DLQWHQDQFH!5HPRWH!7HVW2Q 6. Change the password : if you forgot the Notify Toner password, enter the new password. 7(&+02'(!'$7$6(783!127,)<721(5!5'6!5'63DVVZRUG ,I\RXDUHWRHQDEOHWKH5'6V\VWHP1RWLI\7RQHURSWLRQVKRXOGEH>2II@ 3.3 Call setup & Release In order to perform any RDS activity on a Customer MFP, the SVC will have to setup a call to it. 2QVXFFHVVIXOFRPSOHWLRQRIFDOOVHWXSRQHRUPRUH5'6IXQFWLRQVFDQEHH[HFXWHGEHIRUHFDOOUHOHDVHLV manually initiated. :KHQFRQQHFWLQJWRDGHYLFH5'6ZLOOTXHU\WKH0)3IRUVHULDOQR,I6HULDO1RLVD]HUROHQJWKVWULQJ invalid string, user will be prompted to enter a valid serial no. for the device. If the user chooses not to enter WKHVHULDOQXPEHUDWWKDWSRLQWKHFDQHQWHUHGLWLWODWHUDOVR6HULDOQXPEHUZLOOEHFRQ¿JXUDEOHMXVWOLNHDQ\ other MFP parameter )ROORZLQJVXFFHVVIXOFRQQHFWLRQIROORZLQJGHWDLOVRIWKH0)3ZLOOEHGLVSOD\HG Tel. No, Model, Server Port (that is connected to), Status, Serial Number, Firmware Version, Engine Version, Emulation Version ,QFDVHWKHHVWDEOLVKHGFDOOLVGURSSHGGXHWRDQHUURUFRQGLWLRQ5'6&OLHQW$SSOLFDWLRQZLOOQRWLI\WKHXVHU It will then be necessary to manually request for another call setup to the desired MFP before any RDS function can be reattempted. ,IQRDFWLYLW\LVGHWHFWHGRQDFRQQHFWHGFDOOIRUDPD[LPXPGXUDWLRQRIPLQXWHVVHFRQGVWKHFDOO will be released / disconnected from the MFP-side. Service Manual 4-16 Samsung Electronics Alignment & Troubleshooting 4.1.5.4 Machine Test SWITCH TEST 8VHWKLVIHDWXUHWRWHVWDOONH\VRQWKHRSHUDWLRQFRQWUROSDQHO7KHUHVXOWLVGLVSOD\HGRQWKH/&'ZLQGRZ each time you press a key. MODEM TEST Use this feature to hear various transmission signals to the telephone line from the modem and to check the modem. If no transmission signal sound is heard, it means the modem part of the main board malfunctioned. DRAM TEST 8VHWKLVIHDWXUHWRWHVWWKHPDFKLQH¶V'5$07KHUHVXOWDSSHDUVLQWKH/&'GLVSOD\ ,IDOOPHPRU\LVZRUNLQJQRUPDOO\WKH/&'VKRZV2.!! ROM TEST 8VHWKLVIHDWXUHWRWHVWWKHPDFKLQH¶65207KHUHVXOWDQGWKHVRIWZDUHYHUVLRQDSSHDULQWKH/&'GLVSOD\ )/$6+9(59 (1*,1(9(59 PATTERN TEST Using this pattern printout, you can check if the printer mechanism is functioning properly. It is needed in the production progress. Service person doesn’t need to use it. SHADING TEST 7KHIXQFWLRQLVWRJHWWKHRSWLPXPVFDQTXDOLW\E\WKHVSHFL¿FFKDUDFWHURIWKH&&'&KDUJH&RXSOHG Device). If the copy image quality is poor, perform this function to check the condition CCD unit. < Method > 6HOHFWWKH>$'-8676+$',1*@DWWKH7(&+02'( 2. Push the SET UP button then an image will be scanned. $IWHUWKHVFDQ&&'6+$',1*352),/(ZLOOEH print out. 4. If the printed image is different to the image, the CCD is defect. NOTICE : When you test CCD, make sure that the cover is closed. Service Manual 4-17 Samsung Electronics Alignment & Troubleshooting 4.1.5.5 Report PROTOCOL LIST This list shows the sequence of the CCITT group 3 T.30 protocol during the most recent sending or receiving operation. Use this list to check for send and receive errors. If a communication error occurs while the PDFKLQHLVLQ7(&+PRGHWKHSURWRFROOLVWZLOOSULQWDXWRPDWLFDOO\ OTHER ITEM This list provides a list of the user system data settings and tech mode settings. &RQ¿JXUDWLRQUHSRUW Service Manual 4-18 Samsung Electronics Alignment & Troubleshooting supplies information report Service Manual 4-19 Samsung Electronics Alignment & Troubleshooting 4.1.6 EDC Mode EDC Mode is independently controled system f/w and diagnose printer’s each function. Ŷ0HWKRGWRHQWHU $IWHUWXUQRQWKHV\VWHPSRZHUFKHFNWKH³5HDG\´PHVVDJHRQWKH/&' 2. To enter the EDC Mode, Push the button like next time. ³0HQXĺ6WRSĺ/HIWDUURZĺ%DFNĺ2.ĺ5LJKWDUURZ´ 7KHPHVVDJH³&20321(177(673UHVV0HQX.H\´GLVSOD\RQWKH/&' 7RJHWRXWRIWKH('&0RGH3UHVVWKH³6WRS´NH\ Service Manual 4-20 Samsung Electronics Alignment & Troubleshooting Ŷ('&0RGH0HQX 0. Cover Status Item Front Cover Description :KHQWKHIURQWFRYHURSHQHG³2SHQ´PHVVDJHGLVSOD\/&',IWKHIURQW FRYHUFORVHG³&ORVHG´PHVVDJHGLVSOD\/&' 1. Sensor Status Item Description Regi/Feed/Exit Sensor ,IDFWXDWRULVFKHFNHGE\VHQVRU:LWKRXW3DSHUPHVVDJHZLOOEH GLVSOD\HGLIQRW:LWK3DSHUZLOOEH Empty ,ISDSHUH[LVWVLQWKHWUD\³3UHVHQWZLOOEHGLVSOD\HG,IQRW³(PSW\ZLOO be. 2. Motor Test Item Description Main Mtr Nor. ,I³2.´NH\LVSXVKHGDIWHU³21´GLVSOD\HGPRWRUZLOOEHUXQ0DLQPRWRU ZLOODXWRVWRSDIWHUVHFRQGVDQG´2))´PHVVDJHZLOOEHGLVSOD\HG Slow ,I³2.´NH\LVSXVKHGDIWHU³21´GLVSOD\HGPRWRUZLOOEHVORZO\UXQ 0DLQPRWRUZLOODXWRVWRSDIWHUVHFRQGVDQG´2))´PHVVDJHZLOOEH displayed. 3. Fan Test Item Description Fuser Fan ,I³2.´NH\LVSXVKHGDIWHU³21´GLVSOD\HGIDQZLOOEHUXQ)XVHUIDQZLOO DXWRVWRSDIWHUVHFRQGVDQG´2))´PHVVDJHZLOOEHGLVSOD\HG SMPS Fan ,I³2.´NH\LVSXVKHGDIWHU³21´GLVSOD\HGIDQZLOOEHUXQ6036IDQZLOO DXWRVWRSDIWHUVHFRQGVDQG´2))´PHVVDJHZLOOEHGLVSOD\HG /68)DQ ,I³2.´NH\LVSXVKHGDIWHU³21´GLVSOD\HGIDQZLOOEHUXQ/68IDQZLOO DXWRVWRSDIWHUVHFRQGVDQG´2))´PHVVDJHZLOOEHGLVSOD\HG 4. Clutch Test Item Description Pick up Clutch :KHQ³2.´NH\LVSXVKHGDIWHU´21´PHVVDJHGLVSOD\HGFOXWFKWXUQRQ SLFNXSFOXWFKZLOOEHWXUQRIIDIWHUVHFRQGVDQG´2))´PHVVDJHZLOOEH displayed. Regi Clutch :KHQ³2.´NH\LVSXVKHGDIWHU´21´PHVVDJHGLVSOD\HGFOXWFKWXUQRQ SLFNXSFOXWFKZLOOEHWXUQRIIDIWHUVHFRQGVDQG´2))´PHVVDJHZLOOEH displayed. Service Manual 4-21 Samsung Electronics Alignment & Troubleshooting 5. Fuser Ctrl Item Description Temp Control )XVHURQDQGRII³21´LVVHOHFWHGIXVHUZLOOEHDFWLYHDQGGLVSOD\WKH IXVHUWHPSHUDWXUH>;;;@EXW³2))´LVVHOHFWHGIXVHUZLOOEHVWRSDQG>@ display Fuser Temp. )XVHUWHPSHUDWXUHGLVSOD\HGRQ/&'H[DPSOH>@ 6. LSU Control Item Description /'3RZHU :KHQ³2.´NH\LVSXVKHGDIWHU´21´PHVVDJHGLVSOD\HG´2))´PHVVDJH will be displayed after 10 seconds /680RWRU ,I³2.´NH\LVSXVKHGDIWHU³21´GLVSOD\HGPRWRUZLOOEHUXQ/68PRWRU ZLOODXWRVWRSDIWHUVHFRQGVDQG´2))´PHVVDJHZLOOEHGLVSOD\HG /685HDG\ ,I³2.´NH\LVSXVKHGDIWHU³21´GLVSOD\HGPRWRUZLOOEHUXQ´´PHVVDJH will be displayed. +V\QF ,I³2.´NH\LVSXVKHGDIWHU³21´GLVSOD\HGPRWRUZLOOEHUXQ´´PHVVDJH will be displayed. 7. DEV Control Item Description 7+9 ,I³2.´NH\LVSXVKHGDIWHU³21´GLVSOD\HG7+9ZLOOEHWXUQHGRQ 7+9 ,I³2.´NH\LVSXVKHGDIWHU³21´GLVSOD\HG7+9ZLOOEHWXUQHGRQ Dev Bias ,I³2.´NH\LVSXVKHGDIWHU³21´GLVSOD\HG'HY%LDVZLOOEHWXUQHGRQ 0+9%LDV ,I³2.´NH\LVSXVKHGDIWHU³21´GLVSOD\HG0+9%LDVZLOOEHWXUQHGRQ Ŷ$&521<06$1'$%%5(9,$7,216 '(9'HYHORSLQJ+LJK9ROWDJH ('&(PEHGGHG'LDJQRVWLF&RQWURO ):±)LUPZDUH +936±+LJK9ROWDJH3RZHU6XSSO\ +:+DUGZDUH /'±/DVHU'LRGH /68±/DVHU6FDQQLQJ8QLW 0+90DLQ+LJK9ROWDJH&KDUJH9ROWDJH 23&2SWLFDO3KRWR&RQGXFWRU 6&)6HFRQG&DVVHWWH)HHGHU 7+97UDQVIHU+LJK9ROWDJH Service Manual 4-22 Samsung Electronics Alignment & Troubleshooting 4.1.7 Abnormal Image Printing and Defective Roller If abnormal image prints periodically, check the parts shown below. 7-2 7-1 No Roller Abnormal image period Kind of abnormal image 1 OPC Drum 75.5mm :KLWHVSRW%ORFN6SRWV 2 Charge Roller 26.7mm Block Spot and Periodic Band 3 Supply Roller 47.1mm Periodic Band by little difference of density 4 Developing Roller 35.2mm :KLWH6SRW+RUL]RQWDOEODFNEDQG 5 Transfer Roller 47mm Ghost, Damaged Image by abnormal transfer 6 +HDW5ROOHU 77.8mm Black Spots or Vertical Black Band 7-1 3UHVVXUH5ROOHUBVW 62.8mm Blackground 7-2 3UHVVXUH5ROOHUBVW 37.7mm Blackground Service Manual 4-23 Samsung Electronics Alignment & Troubleshooting 4.1.8 Error Message Messages appear on the control panel display to indicate the machine’s status or errors. Refer to the tables below to understand the messages’ meaning and correct the problem if necessary. Messages and their meanings are listed in alphabetical order. [[[LQGLFDWHVWKHPHGLDW\SH \\\LQGLFDWHVWKHWUD\ Message Meaning Suggested solutions [COMM. Error] The machine has a communication problem. Ask the sender to try again. [Incompatible] The machine has received a fax from which is registered as a junk fax. The received fax data will be deleted. 5HFRQ¿UPMXQNID[VHWXS [Line Error] Your machine cannot connect with the receiving fax machine or has lost contact because of a problem with the phone line. Try again. If the problem persists, wait an hour or so for the line to clear and try again. Or, turn the ECM mode on. [No Answer] The receiving fax machine has not answered after several redial attempts. Try again. Make sure that the receiving machine is operational. [Stop Pressed] Stop/Clear has been pressed during an operation. Try again. [yyy] Paper Empty There is no paper in the tray. /RDGSDSHULQWKHWUD\ [yyy] Paper Mismatch 7KHSDSHUVL]HVSHFL¿HGLQWKHSULQWHU properties does not match the paper you are loading. /RDGWKHFRUUHFWSDSHULQWKHWUD\ Authentication Failure The ID or password you entered is incorrect. Enter the correct ID or password. Cancel? Ĵ Yes Ķ Your machine’s memory has become To cancel the fax job, press the OK full while trying to store an original into button to accept Yes. If you want to memory. send those pages that have been successfully stored, press the OK button to accept No. You should send the remaining pages later, when memory is available. Connection Error Connection with the SMTP server failed. Check the server settings and the network cable. Data Read Fail Check USB Mem. Time expired while reading data. Try again. Data Write Fail Check USB Mem. Storing to the USB memory failed. Check the available USB memory space. Service Manual 4-24 Samsung Electronics Alignment & Troubleshooting Message Meaning Suggested solutions Document Jam The loaded original has jammed in the Clear the jam. ADF. Door Open The front cover is not securely latched. Close the cover until it locks into place. Duplex Jam 0 Check Inside Paper has jammed during duplex printing. This is applicable only to machines with this feature. Clear the jam. Duplex Jam 1 Open/Close Door Paper has jammed during duplex printing. This is applicable only to machines with this feature. Clear the jam. Enter Again You entered an unavailable item. Enter the correct item again. File Format Not Supported 7KHVHOHFWHG¿OHIRUPDWLVQRW supported. 8VHWKHFRUUHFW¿OHIRUPDW Fuser Fan Locked There is a problem in the cooling fan of the machine. Open and then close the front cover. Group Not Available Use a speed dial number or dial a You have tried to select a group number manually using the number location number where only a single location number can be used, such as keypad. when adding locations for a Multiple Send operation. Install Toner The toner cartridge is not installed. Install the toner cartridge. Invalid Toner The toner cartridge you have installed is not for your machine. Install the a Samsunggenuine toner cartridge designed for your machine. ,3&RQÀLFW The network IP address you have set is being used by someone else. Check the IP address and reset it if necessary. Line Busy The receiving fax machine did not Try again after a few minutes. answer or the line is already engaged. Low Power The machine is in the previous stage of the power save mode. :KHQGDWDLVUHFHLYHGLWVZLWFKHVWR on-line automatically. Mail Exceeds Server Support The mail size is larger than the supported size by SMTP server. Divide your mail or reduce the resolution. Main Motor Locked There is a problem in the main motor. Open and then close the front cover. Memory Full The memory is full. Delete unnecessary fax jobs and retransmit after more memory becomes available. Alternatively, split the transmission into more than one operation. Not Assigned The speed button or speed dial number you tried to use has no number assigned to it. Enter the number manually using the number keypad or store the number or address. Service Manual 4-25 Samsung Electronics Alignment & Troubleshooting Message Meaning Suggested solutions Not Available Try Again Later Can not perform the task immediately because too many tasks are running at once. Try again when current task is completed. One Page is Too Large Single page data exceeds the FRQ¿JXUHGPDLOVL]H Reduce the resolution and try again. Operation Not Assigned You are in the Add Page/Cancel Job operation, but there are no jobs stored. Check the display to see if there are any scheduled jobs. Out-Bin Full The output tray of the machine is full of paper. Remove paper. Paper Jam 0 Open/Close Door Paper has jammed in the feeding area Clear the jam. of the tray. Paper Jam 1 Open/Close Door Paper has jammed inside the machine. Paper Jam 2 Check Inside Special print media has jammed in the Clear the jam. paper exit area. Replace Toner This message appears between Toner Replace the toner cartridge with a new (PSW\DQG7RQHU/RZVWDWXV one. Retry Redial? 7KHPDFKLQHLVZDLWLQJIRUDVSHFL¿HG You can press OK to immediately redial, or Stop/Clear to cancel the time interval to redial a previously redial operation. busy station. Scanner locked The scanner module is locked Unlock the scanner and press Stop/ Clear. Self Diagnostics Temperature The engine in your machine is checking problems detected. :DLWDIHZPLQXWHV Self Diagnostics LSU 7KH/68/DVHU6FDQQLQJ8QLWLQ your machine is checking problems detected. :DLWDIHZPLQXWHV Send Error (AUTH) There is a problem in SMTP authentication. &RQ¿JXUHWKHDXWKHQWLFDWLRQVHWWLQJ Send Error (DNS) There is a problem in DNS. &RQ¿JXUHWKH'16VHWWLQJ Send Error (POP3) There is a problem in POP3. &RQ¿JXUHWKH323VHWWLQJ Send Error (SMTP) There is a problem in SMTP. Change to the available server. Send Error :URQJ&RQ¿J There is a problem on the network interface card. &RQ¿JXUH\RXUQHWZRUNLQWHUIDFHFDUG correctly. Service Manual 4-26 Clear the jam. Samsung Electronics Alignment & Troubleshooting Message Meaning Suggested solutions Toner Empty The toner cartridge has run out. The machine stops printing. Press OK to toggle the message to Stop or Continue. Ĵ Stop Ķ You can select the option among Stop or Continue with the left/right arrow. If you select Stop by pressing OK on the control panel, the machine stops printing. If you select Continue, the machine keeps printing, but the quality cannot be guaranteed. If you do not select any, the machine will work as Stop is selected. Replace the toner cartridge with a new one. Toner Exhausted The lifespan of the toner cartridge which the arrow indicates is reached. This message appears when the toner is completely empty, and your machine stops printing. Replace the corresponding toner cartridge with a Samsunggenuine cartridge. Toner Low The corresponding toner cartridge is almost empty. Take out the toner cartridge and thoroughly shake it. By doing this, you can temporarily reestablish printing operations. Updating Data Please Wait... This message appears when there is a change in the system setting or when you back up a data. Do not turn the power off when this message is showing. Changes may not be saved and datas can be lost. Service Manual 4-27 Samsung Electronics Alignment & Troubleshooting 4.2 Troubleshooting 4.2.1 Procedure of Checking the Symptoms %HIRUHDWWHPSWLQJWRUHSDLUWKHSULQWHU¿UVWREWDLQDGHWDLOHGGHVFULSWLRQRIWKHSUREOHPIURPWKHFXVWRPHU Power On *UHHQ/('RQ" - No Power - Power Module error - Main PBA error - Panel PBA error Ready or Power save (UURU/('21" Refer to /('6WDWXV Error Message Test Print printing Quality is 1RPDO" Refer to "Solution of Image Problem" END Service Manual 4-28 Samsung Electronics Alignment & Troubleshooting 4.2.2 The cause and solution of Bad image 1) Vertical Black Line and Band Description : 1. Straight thin black vertical line occurs in the printing. 2. Dark black vertical band occur in the printing. Digital Printer Digital Printer Digital Printer Digital Printer Digital Printer 1. Damaged develop roller in the Toner cartridge. Deformed Doctor-blade or cleaning-blade. 2. Scratched surface of the charge roller in the toner cartridge. 3. Partly depression or deformation on the surface of the transfer roller. Service Manual 4-29 If causes 1 and 2 occur in the toner cartridge, replace the toner cartridge and try to print out. Replace the transfer roller if occurred as No. 3. Samsung Electronics Alignment & Troubleshooting 2) Vertical White Line Description : White vertical voids in the image. Digital Printer Digital Printer Digital Printer Digital Printer Digital Printer 1. Foreign matter stuck onto the window of internal lenses RI/68PLUURU. 2. Foreign matter or toner particles between the toner cartridge roller and blade. (In case the life of the toner cartridge has been expired, white lines or light image occur in front of the image.) Replace the toner cartridge. 3. It may occur when Burr and foreign substances are on the window of the toner cartridge frame. No 3. : Remove the foreign matter and burr of the exposure window. (toner cartridge) 4. If the fuser is defective, voids occur periodically at the top of a black image. No. 4. : Open the front cover and check ribs that corresponds to the position of the voids. Remove if found. 5. It may occur when foreign substances are on the OPC Drum. 6. Partly depression or deformation on the surface of the transfer roller Service Manual Foreign matter stuck onto the ZLQGRZ&OHDQWKH/68ZLQGRZ with recommended cleaner(IPA) Clean the window with a clean cotton swab. 4-30 If the problems are not solved, replace the toner cartridge. Replace the transfer roller if occured as NO.6 Samsung Electronics Alignment & Troubleshooting 3) Horizontal Black Band Description : Dark or blurry horizontal stripes occur in the printing periodically. (They may not occur periodically.) Digital Printer Digital Printer Digital Printer Digital Printer Digital Printer Service Manual 1. Bad contacts of the voltage terminals to toner cartridge. Clean each voltage terminal of the Charge, Supply, Develop and Transfer roller. (remove the toner particles and paper particles) 2. The rollers of toner cartridge may be stained. Charge roller = 26.7mm Supply roller = 47.1mm Develop roller = 35.2mm Transfer roller = 47mm 1. Clean the right Gear that has relatively small gap of the teeth in the OPC. 2. If the malfunction persists, replace the toner cartridge. 4-31 Samsung Electronics Alignment & Troubleshooting 4) Black/White Spot Description : 1. Dark or blurry spots occur periodically in the printing 2. White spots occur periodically in the printing Digital Printer Digital Printer Digital Printer Digital Printer Digital Printer 1. If dark or blurry black spots occur periodically, the rollers in the Toner cartridge may be or be contaminated contaminated with with foreign foreign matter matte or paper particles. 26.7 mm interval ( Charge roller : 37.7 OPC drum : 75.5 mm interval) 2. If faded areas or voids occur in a black image at intervals of 75.5 mm, or black spots occur elsewhere, the OPC drum surface is damaged. 3. If a black image is partially broken, the transfer voltage is abnormal or the transfer roller's life has expired. Service Manual 4-32 Run OPC cleaning Mode Print and run the Self-test 2 or 3 times. In case of 75.5 mm interval unremovable in 1, cleanly remove foreign substances stuck on the OPC location equivalent to black spots and white spots with a dry duster. 1. The transfer roller guarantees 50,000 sheets printing. If the roller's life is expired, replace it. 2. In case of 75.5 mm interval unremovable in 1, take measures as to replace the toner cartridge and try to print out. 3. Clean the inside of the set against the paper particles and foreign matter in order not to cause the trouble. Samsung Electronics Alignment & Troubleshooting 5) Light Image Description : The printed image is light, with no ghost. Digital Printer Digital Printer Digital Printer Digital Printer Digital Printer 1. Develop roller is stained when the toner of toner cartridge is almost consumed. No 1 : Replace the toner cartridge and try to print out. 1R:ait 30 minutes after printer is powered on before you start printing. 2. Ambient temperature is below than 10. 3. Bad contact caused by the toner stains between the high voltage terminal in WKH+936DQGWKHRQH in the set. 4. Abnormal output IURPWKH+936 5XQVHOIWHVWDQGFKHFNa Service Manual Check if the Toner Save mode is off. Check if the density is light. 4-33 No3 : Clean up the contaminated area by the toner. 5HSODFHWKH+936LIWKH problems are not solved by the above four instructions. Samsung Electronics Alignment & Troubleshooting 6) Dark Image or a Black Page Description : The printed image is dark. Digital Printer Digital Printer Digital Printer Digital Printer Digital Printer 1. No charge voltage in the engine board. Service Manual Check the state of the connector which connects the engine board DQG+936 2. Charge voltage is not turned on due to the bad contacts between power supply in the side of the Toner cartridge and charge terminal RI+936 1. Clean the high voltage charge terminal. 5HSODFHWKH+936LIQRWVROYHG by the above direction 1 and 2. 3. VD0 signal of the Main PBALV/RZVWDWH 5HSODFHWKH/688QLWRU0DLQ3%$ 4-34 Samsung Electronics Alignment & Troubleshooting 7) Uneven Density Description : Print Density is uneven between left and right. 1. The pressure force on the left and right springs of the transfer roller is not even, the springs are damaged, the transfer roller is improperly installed, or the transfer roller bushing or holder is damaged. 2. The life of the Toner cartridge has expired. 3. The toner level is not even on the toner cartridge roller due to the bad blade. Service Manual 4-35 Replace both the left and right 6SULQJ+ROGHU. Occur in the toner cartridge gently shake the toner cartridge. Replace the toner cartridge and try to print out. Samsung Electronics Alignment & Troubleshooting 8) Background Description : Light dark background appears in whole area of the printing. Digital Printer Digital Printer Digital Printer Digital Printer Digital Printer 1. Does character exist less than 2% per a page, and hasnÕt it been XVHGORQJWLPH" ,VDUHF\FOHGWRQHUFDUWULGJHEHXVHG" The A/S is not guaranteed if using a recyled the toner cartridger. +DVWKHOLIHVSDQRIWKHWRQHU FDUWULGJHHQGHG" Replace the toner cartridge when the life span of it has been ended. 4. Is the movement(Up and Down) RIWKHWUDQVIHUUROOHUVPRRWK" Clean the bushing part of the transfer roller. 1. If the problem is still not solved, replace the toner cartridge. 2. Gently shake the toner cartridge. ,VWKH+936QRUPDO" Service Manual The toner cartridge is basically designed to print 7K sheets with 5% image. If it prints more than 8K sheets with 2% coverage, a background can occur. 4-36 Samsung Electronics Alignment & Troubleshooting 9) Ghost (1) Description : Ghost occurs at 75.5 mm intervals of the OPC drum in the whole printing. 75.5mm Digital Printer Digital Printer Digital Printer Digital Printer Digital Printer Digital Printer 1. Bad contacts caused by contamination from toner particles between high voltage terminal in the main body and the electrode of the Toner cartridge. Clean the terminals when contaminated by toner particles. 2. Bad contacts caused by contamination from toner particles between high voltage terminal in the main body and the one in the +936ERDUG Occur in the toner cartridge, replace the toner cartridge and try to print out. 3. The life of toner cartridge is expired. 4. Transfer roller lifetime(50K sheets) has expired. Replace the engine board if not solved by the above directions 1-2. If not solved by the direction 3, check the transfer roller lifetime and replace it. Continue.. Service Manual 4-37 Samsung Electronics Alignment & Troubleshooting Continue.. :ait about 1 hour after power on before using printer. 5. Abnormal low temperature (below 10). Occur in the toner cartridge, replace the toner cartridge and try to print out. 6. Damaged cleaning blade in the toner cartridge. Service Manual 4-38 Samsung Electronics Alignment & Troubleshooting 10) Ghost (2) Description : Ghost occurs at 75.5 mm intervals of the OPC drum in the whole printing. (When printing on card stock or transparencies using manual feeder) 75.5mm Digital Printer Digital Printer Digital Printer Digital Printer Digital Printer Digital Printer :KHQSULQWLQJRQFDUGVWRFN thicker than normal paper or WUDQVSDUHQFLHVVXFKDV2+3, higher transfer voltage is required. Service Manual 4-39 Select 'Thick Mode' on paper type menu from the software application and after using returning to the original mode is recommended. Samsung Electronics Alignment & Troubleshooting 11) Ghost (3) : Fuser Description : Ghost occurs at 62.8 mm or 77.6mm intervals. 62.8 or 77.6mm Digital Printer Digital Printer Digital Printer Digital Printer Digital Printer Digital Printer The temperature of the fuser is maintained high. Service Manual 4-40 Disassemble the fuser and remove the contaminated toner particles on the roller and clean the foreign matter between Thermistor and +HDWUROOHU. (Caution: can be deformed) Samsung Electronics Alignment & Troubleshooting 12) Stains on the Face of Page Description : The background on the face of the printed page is stained. Digital Printer Digital Printer Digital Printer Digital Printer Digital Printer Service Manual 1. Toner leakage due to improperly sealed toner cartridge. Replace the toner cartridge. 2. If the transfer roller is contaminated, stains on the face of page will occur. If the transfer roller is contaminated, run PC Cleaning Mode Print 2 or 3 times. And perform Self-Test 2 or 3 times to remove contamination. 4-41 Samsung Electronics Alignment & Troubleshooting 13) Stains on Back of Page Description : The back of the page is stained at 47 mm or 62.8mm intervals. 47 or 62.8mm Digital Printer Digital Printer Digital Printer Digital Printer Digital Printer Digital Printer Perform the OPC Cleaning Mode Print 2 or 3 times. Run Self-Test to remove the contamination of the transfer roller. 1. 47mm : Transfer roller is contaminated. 2. 62.8mm : Pressure roller is contaminated. Service Manual 4-42 1. Replace the transfer roller if contaminated severely. 2. Disassemble the fuser and clean WKH+5+HDW5ROOHUDQG35 (Pressure roller). And check the DUHDEHWZHHQ+5DQGThermistor. If contaminated, clean the area not to be deformed. Samsung Electronics Alignment & Troubleshooting 14) Blank Page Print out (1) Description : Blank page is printed. Digital Printer Digital Printer Digital Printer Digital Printer Digital Printer Bad ground contacts in OPC and/or toner cartridge. Service Manual 4-43 1. Check if the Ground-OPC is defective(set inside right side). 2. Remove contamination of the terminals of the toner cartridge and the unit. Samsung Electronics Alignment & Troubleshooting 15) Blank Page Print out (2) Description : 1. Blank page is printed. 2. One or several blank pages are printed. 3. When the printer turns on, several blank pages print. 1. Bad ground contacts in OPC and/or toner cartridge. 1. Perform the engine self test using EDC Mode to check if the Solenoid is normal. 2. If not solved by the above directions 1-2, Replace the engine board. 3. Turn the power off, delete the data of PC and try printing again. 2. Abnormal solenoid. Service Manual Remove contamination of the terminals of the toner cartridge. 4-44 Samsung Electronics Alignment & Troubleshooting 4.2.3 The cause and solution of the bad discharge 1) Wrong Print Position Description : Printing begins at wrong position on the paper. :rong sense time caused by defective feed sensor actuator. Service Manual Replace the defective actuator 4-45 Samsung Electronics Alignment & Troubleshooting 2) JAM 0 Description : 1. Paper is not exited from the cassette. 2. Jam-0 occurs when the paper feeds into the printer 1. Check the Solenoid by using EDC Mode. Replace the solenoid. 2. Check if the pad is loose due to bad sealing of the side-pad. Replace the side-pad Assembly / or R, if necessary. 3. Check the surface of the roller-pickup for foreign matter. Clean with soft cloth dampened with IPA(Isopropyl Alcohol) or water. 4. If continuous clusters occur, check whether the assembly slot between shaft-pickup and housing-pickup opens or is broken away. Replace the Main PBA and/or Sensor. 5. If the paper feeds into the printer and Jam 0 occurs, perform EDC Mode to check feed-sensor of the engine board. Service Manual 4-46 Samsung Electronics Alignment & Troubleshooting 3) JAM 1 Description : 1. Recording paper is jammed in front of or inside the fuser. 2. Recording paper is stuck in the discharge roller and in the fuser just after passing through the Actuator-Feed. Service Manual 1. If the recording paper is jammed in front of or inside the fuser. Replace the SMPS or Exit-Sensor. 2. If the recording paper is stuck in the discharge roller and the fuser just after passing through the Actuator-Feed, Feed Actuator may be defective. 1. Replace the Main PBA. 2. Reassemble the Actuator-Feed and Spring-Actuator if the movement is bad. 4-47 Samsung Electronics Alignment & Troubleshooting 4) JAM 2 Description : 1. Recording paper is jammed in front of or inside the fuser. 2. Recording paper is stuck in the discharge roller and in the fuser just after passing through the Actuator-Feed. 1. If the paper is completely fed out of the printer, but Jam 2 occurs : Exit sensor is defective. ¥ After the paper is completely discharged, actuator Exit should return to the original position to shut the photo-sensor. Sometimes it takes longer hour than it should and does not return. Check if the exit sensor actuator is defective. ¥ Check if the actuator exit is deformed (Check if the lever part is deformed in shape). ¥ Check whether burrs occur in the assembly part of the actuator exit or not and if the actuator is smoothly operated. ¥ Check if foreign matter and wire get caught in the actuator exit's operation. 2. If the paper is rolled in the Fuser Roller: ¥ This occurs when a Guide claw is broken away or transformed. ¥ It occurs when the Spring of a Guide claw is broken away or transformed. ,WRFFXUVZKHQWKH+HDW5ROOHURU Pressure-Roller is seriously contaminated with the toner. 3. Paper is accordion in the fuser. Service Manual 4-48 If the paper is stuck in the fuser : disassemble the fuser and remove the jammed paper, and clean the surface of the pressure roller with dry gauze. Remove the jammed paper after disassembling the fuser : Clean the surface of the pressure roller with dry gauze. ¥ Remove the toner particles stained on the rib. ¥ Check the assemblage and performance of the exit. Samsung Electronics Alignment & Troubleshooting 5) JAM Duplex Description : Recording paper is Jamned in front or inside a duplex module. 1. A case that a paper jam occurs on (A) after it is reversed: replace a 2nd exit roller after checking its operation. 2. A case that a paper jam occurs on (B) after it is reversed: replace a duplex roller after checking its operation 2. It is a case that a paper cannot reach to a registration sensor. Service Manual 4-49 Samsung Electronics Alignment & Troubleshooting 6) Multi-Feeding Description : Multiple sheets of paper are fed at once. &KHFNWKH*XLGHVLGH/5RU*XLGH Rear in the Cassette, if the position is correct. Replace the solenoid if necessary. 2. Solenoid malfunction (the solenoid does not work properly): Perform EDC Mode. Service Manual Replace the Main PBA. 3. Pad-Friction is contaminated with foreign matter.(oil...) Clean the pad friction with soft cloth dampened with IPA (Isopropyl Alcohol). 4. The face of paper is blended. Use the smooth paper. 4-50 Samsung Electronics Alignment & Troubleshooting 7) Paper rolled in the fuser Description : If contaminated at intervals of 77.6mm on the back of a paper. After disassembling the fuser, clean contamination between the heat roller and the thermostor and remove the contamination of the pressure roller. 1. Contamination of the pressure roller or heat roller %DFNJURXQG+RWRIf set). 1. If there is heavy background, repair it by the background troubleshooting method. 2. Clean the surface of the heat roller with IPA or water 3. Check the warp or separation of the print claw and the holder plate claw, and then manage it. 2. Check the claw of the fuser whether it is deformed. Service Manual 4-51 Samsung Electronics Alignment & Troubleshooting 8) Paper rolled on the OPC Drum Description : Paper is rolled up in the OPC. Recommend to use normal paper. 1. Paper is too much thin. +RZWRUHPRYHWKHUROOHGSDSHU in the OPC. Remove the paper while turning the OPC against the ongoing direction. Clean fingerprints on the OPC softly with soft cloth dampened with tissue. 2. The face of paper is curled. Service Manual 4-52 Samsung Electronics Alignment & Troubleshooting 4.2.4 The cause and solution of the malfunction 1) Fuser Error Description : Fuser error is displayed on LCD Replace the fuser if a thermostat is open. 1. Check whether a thermostat, AC wire, and heat lamp are open or not. 2. Check whether a thermistor is open or not. Replace the fuser if a thermistor sensor is located deep inside of a sponge. +HDWODPS212))WHVW Check whether the overheat mode circuit operates normally or not. 4. It could not operate due to a gear of a fuser is melted. Service Manual Replace the fuser. 4-53 Samsung Electronics Alignment & Troubleshooting 2) LSU Error Description : “PMOTOR ERROR/HSYNC ERROR’ &KHFNZKHWKHUWKH/68 connector is disconnected or not. 5HSODFHD/68 Replace a main board if the same error occurs again after replacing D/68 &KHFNZKHWKHUWKH/68 motor is rotating or not. &KHFNWKH+6<1&VLJQDO Service Manual 4-54 Samsung Electronics Alignment & Troubleshooting 3) Not function of the gear of the fuser due to melting away Description : The motor breaks away from its place due to gear melting away. 1. Replace the Fuser. 2. Replace the Main PBA. 3. Replace the SMPS. &KHFNWKH+HDW/DPS Service Manual 4-55 Samsung Electronics Alignment & Troubleshooting 4) Paper Empty Description : Paper empty error message is displayed on LCD when paper is loaded in the cassette. 1. Bending or deformation of the actuator of the paper sensor. Replace the defective actuator. 2. The function of the engine board is defective Replace the Sensor PBA. 3. Check the Connector. Service Manual 4-56 Samsung Electronics Alignment & Troubleshooting 5) Paper Empty without indication Description : Paper empty error message does not display when the paper cassette is empty. 1. Bending or deformation of the actuator of the paper sensor. Replace the defective actuator. 2. The function of the engine board is defective Service Manual Replace the engine board. 4-57 Samsung Electronics Alignment & Troubleshooting 6) Cover Open Description : The ERROR lamp is on even when the print cover is closed. 1. The hook lever in the front cover or Guide rear may be defective. Replace the hook lever, if defective. 2. Check the connector and circuit of the cover switch department in the Main Control board. Service Manual 4-58 1. Check the insertion of the &RYHU2SHQ6:&RQQHFW 2. Replace the Main Control ERDUGRU&RYHU2SHQ6:. Samsung Electronics Alignment & Troubleshooting 7) No error LED when the cover is open Description : The Error LED does not come on even when the printer cover is open 1. Check the connector and circuit of the cover switch department in the Main Control board. Perform EDC test Service Manual 4-59 1. Check the insertion of the &RYHU2SHQ6:&RQQHFW 2. Replace the Main Control ERDUGRU&RYHU2SHQ6:. Samsung Electronics Alignment & Troubleshooting 8) No Power Description : When system power is turned on, all lamps on the operator panel do not come on. Replace the power supply cord or SMPS. 1. Check if the power input and SMPS output are normal. 2. Check the inferiority RI/('3DQHORU/'&ZLQGRZRQWKH front-cover if the OP panel does not appear after normal warming-up. Service Manual 4-60 1. Replace the control board. 2. Replace the OP panel. Samsung Electronics Alignment & Troubleshooting 9) Vertical Line Getting Curved Description : When printing, vertical line gets curved. ,IWKHVXSSO\RIYLV unstable in the Main Control board OLQNLQJZLWK/68FKHFNGULYHE\ EDC Mode: /68&KHFN 5HSODFH/68 1. Replace theToner Joint PBA. 2. Replace the MainPBA. 2. Chect the Deve PBA in the Toner Cartridge. Service Manual 4-61 Samsung Electronics Alignment & Troubleshooting 4.2.5 The cause and solutions of bad environment of the software 1) The printer is not working (1) Description : While Power turned on, the printer is not working in the printing mode. Check the power of the printer and perform the Self-Test. If the test printing works, that means no problems in the printer itself. If the test printing does not work, that means bad functioning of the printer (not because of software). 1. Run Self-Test Mode: Turn the power on while pressing the test printing button for 2 or 3 seconds before printing works. Replace the printer cable. If the problems not solved even after the cable replaced, check the amount of the remaining tone. 2. Check if the PC and the printer is properly connected and the toner cartridge installed. Check if the connection between PC and printer port is proper. If you use windows, check if the printer driver in the controller is set up. If the printer driver is properly set up, check in which program the printing is not working. The best way to find out is to open the memo pad to check the function of printing. If it is not working in a certain program, adjust the setup the program requires. Sometimes, WKHSULQWRXWLVQRUPDOZLWKLQWKH:LQGRZVEDVLF programs, but it's not working in a particular program. In such case, install the new driver again. ,IQRWZRUNLQJLQWKH:LQGRZVEDVLFSURJUDP Check the setup of the port of CMOS is on ECP. And check the address of IRQ 7 and 378 3ULQWLQJLVQRUZRUNLQJLQWKH:LQGRZV 4. Check if the printer cable is directly connected to peripheral devices Service Manual If the scanner needs to be connected to the printer, first the remove the scanner from the PC to see if the printer is properly working alone. 4-62 Samsung Electronics Alignment & Troubleshooting 2) The printer is not working (2) Description : After receiving the printing order, no response at all or the low speed of printing occurs due to wrong setup of the environment rather than malfunction of the printer itself. Not working with the message 'insufficient printer memory' means hard disk space problem rather than the RAM problem. In this case, provide more space for the hard disk. Secure more space using the disk utilities program. 1. Secure more space of the hard disk. 2. Printing error occurs even if there is enough space in the hard disk. The connection of the cable and printer port is not proper. Check if the connection is properly done and if the parallel port in CMOS is rightly set up. 3. Check the parallel-port-related items in the CMOS Setup. As a printer port, Select ECP or SPP among SPP(Normal), ECP, and EPP modes(increase printing speed) SPP normal mode support 8-bit data transfer, while ECP Mode transfer the 12-bit data. If the regular font is not printing, the cable or the printer driver may be defective. Turn the PC and printer off, and reboot the system to print again. If not solved, double-click the printer in my computer If the regular fonts are not printed this time again. the cable must be defective so replace the cable with new one. 4. Reboot the system to print. Service Manual 4-63 Samsung Electronics Alignment & Troubleshooting 3) Abnormal Printing Description : The printing is not working properly even when the cable has no problem. (even after the cable is replaced) If the printer won’t work at all or the strange fonts are repeated, the printer driver may be defective or wrong setup in the CMOS Setup. Select SPP(Normal) or ECP/37 Port the among ECP, EPP or SPP in the CMOS Setup. 1. Set up the parallel port in the CMOS SETUP. Check the printer in My Computer. (to see if the printer driver is compatible to the present driver or delete the old driver, if defective and reinstall the new driver) 2. Printer Driver Error. 3. Error message from insufficient memory. (The printing job sometimes stops or due to insufficient virtual memory, but it actually comes from the insufficient space of the hard disk.) Service Manual Delete the unnecessary files to secure enough space of the hard disk and start printing job again. 4-64 Samsung Electronics Alignment & Troubleshooting 4) SPOOL Error Description : To spool which stands for “simultaneous peripheral operations online” a computer document or task list (or “job”) is to read it in and store it, usually on a hard disk or larger storage medium so that it can be printed or otherwise processed at a more FRQYHQLHQWWLPHIRUH[DPSOHZKHQDSULQWHULV¿QLVKHGSULQWLQJLWVFXUUHQWGRFXPHQW 1. Insufficient space of the hard disk in the directory assigned for the basic spool. Delete the unnecessary files to provide more space to start printing job. If there are some files with the extension name of ****.jnl, Delete them and Reboot WKH:LQGRZVWRUHVWDUWSULQWLQJMRE 2. If the previous printing error not solved. Shut down all other programs except the current one, if possible. :KHQH[SHFWHGWRFROOLGH with other program. :KHQDQDSSOLFDWLRQ program or the printer driver is damaged. Delete the printer driver completely and reinstall it. After rebooting the computer, check for viruses, restore the damaged files and reinstall the program to do the printing job. :KHQVRPHILOHVUHODWHGWR OS are damaged or virus infected. 6. Memory is less than suggested one. Add up enough memory to the PC. How to delete the data in the spool manager. In the spool manager, the installed drivers and the list of the documents waiting to be printed are shown. Select the document to be deleted and check the delete menu. If you intend to delete the current document being printed, the data being transferred to the printer will be put out and then the document is removed. Before choosing the document, the menu is still inactive. 2USXWWKHGRFXPHQWRXWRIWKHOLVWDQGUHSHDWWKHURXWLQHDVLQWKHDERYHRU¿QLVKWKH spool manager. Service Manual 4-65 Samsung Electronics Alignment & Troubleshooting 4.2.6 Fax & Phone Problems 1) No Dial Tone Description : While on-hook button is pressed, there is no dial tone. Service Manual 1. Check if the telephone line cord is connected to 7(//,1(FRUUHFWO\. If the telephone cord is normal but there is no dial tone, then try to UHSODFHWKH/,8% G &KHFNLILWPDNHV&/,&. VRXQGZKLOH2+'NH\LVSUHVVHG ,I\RXFDQQRWKHDUWKH2+' &/,&.VRXQGWKH23(Ass'y may be defective. Try to replace the OPE Ass'y. 3. Check the connection of +$51(66EHWZHHQWKH /,8DQGWKH0DLQ% G Check the Speaker connection, and try to replace it. 4. Check if the SPEAKER is connected correctly. /DVWO\, try to replace the Main B'd. 4-66 Samsung Electronics Alignment & Troubleshooting 2) Defective MF DIAL Description : The MF DIAL is not functioning. Service Manual 1. Check if the telephone line is connected correctly. ,I\RXFDQQRWFDWFKWKH2+' &/,&.VRXQGWKH23(Ass'y may be defective. Try to replace the OPE Ass'y. :LOHWKH%877ON KEY is pressed, check to catch D&/,&.VRXQG ,I\RXFDQFDWFKD&/,&.VRXQG after checking the connection of +$51(66EHWZHHQWKH/,8DQG the Main PBA, try to replace the +$51(66 3. Check the connection of +$51(66EHWZHHQWKH /,8DQGWKH0DLQ3%$ The problem still persists, then UHSODFHWKH/,8DQGWKHPDLQ% G in sequence. Notes: Product supports the MF ',$/ type only. 4-67 Samsung Electronics Alignment & Troubleshooting 3) Defective FAX FORWARD/RECEIVE Description : The FAX FORWARD/RECEIVE is not functioning. 1. Check if you can catch a dial tone by pressing 2+' If the MODEM testing is normal and there is no dial tone, then try WRUHSODFHWKH/,8% G 2. Check if you can catch a RECEIVE tone while MODEM testing in the 7(&+0RGH Service Manual If the MODEM testing is abnormal, try to replace the Main B'd. 4-68 Samsung Electronics Alignment & Troubleshooting 4) Defective FAX FORWARD Description : RECEIVE is functioning, but FORWARD is not functioning or the received data are broken. 1. Check if there is NOISE when pressing on-hook dial. If it makes NOISE while using on-hook dial, replace or repair the telephone line. 2. Check the RECEIVE condition by trying to forward a FAX to another fax machine from the forwarding side FAX. 3. Check if the telephone line connected to the Product is contaminated or gets stripped off or down. Service Manual 4-69 Samsung Electronics Alignment & Troubleshooting 5) Defective FAX RECEIVE (1) Description : FORWARD is functioning, but RECEIVE is not functioning or the received data are broken. 1.Check if there is NOISE when pressing on-hook dial. If it makes NOISE while on-hooking, replace or repair the telephone line. 2.Check the RECEIVE condition by trying to receive a FAX at another fax machine. Service Manual 4-70 Samsung Electronics Alignment & Troubleshooting 6) Defective FAX RECEIVE (2) Description : The received data are lengthened or cut in the printing. 1. Check if there is NOISE when pressing on-hook dial. If it makes NOISE, rearrange the telephone line. (Refer to 'Defective FAX RECEIVE'.) 2. Ask to the forwarding side, check the image quality of another machine receiving a FAX additionally sent to. Service Manual 4-71 Check if the FAX status of the forwarding side is also normal. Samsung Electronics Alignment & Troubleshooting 7) Defective FAX RECEIVE (3) Description : The phone is ringing continuously, but it cannot receive. Even when the RECEIVE Mode is changed to FAX MODE, it cannot UHFHLYHWKHQUHSODFHWKH/,8DQG the Main B'd in sequence. Check if the RECEIVE Mode is 7(/ MODE or FAX MODE. Service Manual 4-72 Samsung Electronics Alignment & Troubleshooting 8) Defective FAX RECEIVE (4) Description : The received data is reduced by more than 50% in the printing. After checking the data of the forwarding side, correct the FAX of the forwarding side. Check the FAX status of the forwarding side. Service Manual 4-73 Samsung Electronics Alignment & Troubleshooting 9) Defective Automatic Receiving Description : The automatic receiving function is not working. 1. If the RECEIVE Mode is set to the 7(/ MODE, reset it to the FAX MODE. 2. Even after the RECEIVE Mode is changed to the FAX Mode, it cannot receive, then try to UHSODFHWKH/,8DQGWKH0DLQ B'd in sequence. 1. Check if the RECEIVE Mode is 7(/ MODE or FAX MODE. Service Manual 4-74 Samsung Electronics Alignment & Troubleshooting 4.2.7 Copy Problems 1) Black Copy Description : Black page is printed out when copy. Room light ca transit a thin original. 1. Check the Scan-Cover open. Service Manual 2. Check shading profile. Remake shading profile in the tech mode. 3. Check white/black reference voltage in Main PBA. Replace U60 if it is defective. . U60-154 = 0.5V . U60-155 = 3.3V 4-75 Samsung Electronics Alignment & Troubleshooting 2) White Copy Description : White page is printed out when Copy. 1. Check the CIS problem in Main PBA. Check the CIS harness contact. 2. Check shading profile. Remake shading profile in the tech mode. Service Manual 4-76 Samsung Electronics Alignment & Troubleshooting 3) Abnormal noise Description : There is noise when copy. Check the right position of the Scanner Motor, and check the any mechanical disturbance in the CIS carriage part. 1. Check the Scanner Motor and any mechanical disturbance. 2. Check the Motor Driver in Driver PBA. Service Manual 4-77 If any driver is defective, replace it. . Connection PBA U4-1, 19 or U5-1, 19=0V to 24V swing signal when operating. Samsung Electronics Alignment & Troubleshooting 4) Defective Image Quality Description : The copied image is light or bad. Remake shading profile in the tech mode. 1. Check shading profile. Service Manual 2. Check the gap between original and scanner glass. The gap above 0.5 mm can cause a blurred image. 3. Check printing quality. See "Print" troubleshooting. 4-78 Samsung Electronics Alignment & Troubleshooting 4.2.8 Scanning Problems 1) Defective PC Scan Description : The PC Scan is not functioning at all. 1. Check the Cable (USB or Parallel) If the PC and the cable are not connected properly, reconnect it. 2. Check if the driver is installed properly. After confirming that it is proper by performing a PC printing test related to driver setup, if it is not so, reinstall it. (Refer to User's Manual.) If copy function works, replace the Main PBA. If copy function doesn't work, replace the CIS Ass'y and try again. 3. Check if copy function operates normally. Service Manual 4-79 Samsung Electronics Alignment & Troubleshooting 2) Defective Image Quality of PC Scan Description : The image PC scanned is not clear or bad. Service Manual 1. Check the waveform form by performing a CIS test in 7(&+0RGH If the CIS waveform form is abnormal, try to replace the CIS Ass'y. 2. Check if the resolution is set too low in PC Scan options. (Refer to User's Manual.) If the resolution is set to low, let the user be acquainted with the using method well. 4-80 Samsung Electronics
advertisement
* Your assessment is very important for improving the workof artificial intelligence, which forms the content of this project
Related manuals
advertisement